DPCstruct | MC36161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 119 ± 11 aa |
| Standard deviation of domain lengths | 10.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 50.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9NTA2 | 2-107 | NPLEICNVTDKNLAKFPKKLGSIGNWIQCRGMIYNEKDDNDAGVLCGKWRRSPLFVTQTDNWDCFCSVVWDPFHSDCAVPQEIETDE… |
| A0A446XVX7 | 7-118 | CDDYFGEPAELDATEMTNLSLQLSLRREDKKTSIGNWIQCQEVLDTGAICGKWRRAPLFVVQSSDWDCSCSVLWDPIHADCAVPQEL… |
| A0A2U1MU83 | 35-169 | None |
| A0A4U5NQI7 | 582-703 | None |
| A0A453HWS7 | 236-356 | None |
| A0A6V7NXG9 | 32-147 | None |
| A0A5D2KMQ1 | 703-823 | None |
| A0A5A7USR9 | 3-142 | None |
| A0A0A9LBJ7 | 82-200 | None |
| W9QPE2 | 166-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.