DPCstruct | MC36160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 152 ± 22 aa |
| Standard deviation of domain lengths | 21.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6XNP7 | 3-144 | EVYVIAGGEWLRNNLNAIAAFMSTRTWDSIEKIALTLSVVAVAFMWVQRHNVMDLLGWVAVFVLISLLVNVRTSVQIIDNSDLVKVH… |
| A0A2D3RJ12 | 1-154 | MLELFTIGGGEYIVNVLNAVSAWTGGGGYKSMIRVVMVMGLIYTLLIVAFSLDWRAWFNWFLQATLIYLCLMVPTVTIQVTDRVNPG… |
| A0A4R1P0H5 | 4-144 | None |
| A0A522DQR0 | 3-175 | None |
| A0A7W6A1C4 | 1-154 | None |
| A0A484VJT3 | 1-152 | None |
| A0A7W1HH75 | 5-160 | None |
| A0A828M1I9 | 1-152 | None |
| A0A0U5JJK9 | 3-167 | None |
| A0A2Z6IE50 | 5-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.