DPCstruct | MC36158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 4.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 96.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 59.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6XDC1 | 1-56 | MNYPAEPFRIKSVETVSMIPRDERLKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAM |
| A0A6M1CIS1 | 1-66 | MKRIPEPFRIKMVENIRMTTRNEREVALKEAGYNPFLLPGDVVFIDLLTDSGTGAMSDRQWAGLMM |
| W4TQK5 | 1-66 | None |
| A0A0D7CN95 | 16-81 | None |
| A0A0U1HW37 | 1-56 | None |
| A0A4Q2WJ00 | 4-69 | None |
| A4N0F6 | 4-69 | None |
| X2JXE0 | 22-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.