DPCstruct | MC36157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 145 ± 25 aa |
| Standard deviation of domain lengths | 25.11 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.55 |
| Pfam Score | 72.32 |
| Assigned Pfam label(s) | PF19425- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M5ZAI6 | 1-182 | MAGIVRTSLAAALAGQPALAGAAGSVSAQLAELLPLSRQARRGDHFSLLVDVERLDGGERAYSAKLMGFDYQGARLQASAARFDDDR… |
| A0A6N6XCQ0 | 1-141 | DWVNSRIKGTVGGSFVASAKEAGLTSSEISAVIKAMQWQMDFRKLKKGDEFSVLMSREMLDGKREQSQLLGVRLRSEGKDYYAIRAE… |
| A0A4Y9EME4 | 231-401 | None |
| A0A2G1YUN4 | 121-296 | None |
| A0A1E3WCV6 | 15-150 | None |
| A0A376VGN5 | 70-191 | None |
| A0A7V2EDU0 | 88-287 | None |
| A0A1H0AH41 | 54-199 | None |
| A0A1E3VXH9 | 137-268 | None |
| A0A537NIX1 | 24-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.