DPCstruct | MC36151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 138 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6XAN9 | 107-241 | RRFFEVTGLVGMRVEDEAVFQDTHRLILELVRSGAVDGLRIDHVDGLADPKSYVEKLRQEAGPDCYITVEKILGKGEHLPEEWPISG… |
| A0A655JL47 | 1-129 | MFDASHAEVARWFTEGLVDGVRVDHLDGLSDPSGYLAQLRELLGPNAWIVVEKILAVDEALEPTLPVDGSTGYDVLREIGGVLVDPQ… |
| A0A2V8HSD1 | 86-243 | None |
| A0A1Z1WLF9 | 110-288 | None |
| A0A1A9GC89 | 150-293 | None |
| A0A1E3VRN0 | 2-115 | None |
| A0A7C1H7F3 | 189-330 | None |
| A0A532E898 | 193-326 | None |
| A0A2V6QTL2 | 148-294 | None |
| A0A2V7WZH5 | 296-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.