DPCstruct | MC36150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 149 ± 11 aa |
| Standard deviation of domain lengths | 10.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6X9P9 | 1-153 | TLHPQIRPVDKSVIETRLEKWRALRQPQGVPGITAQEVGAIARFWQSTVPGGKQHMDDALWHQFALLIPSLDLSTRASVWSLLWGEQ… |
| A0A3S6EXR8 | 167-316 | YQPDAHSITEHLNLLAMHRQSQAVSGITEDDVVTLWDYLLRQDKNSQSLLNTHFWPTAIELAPCLSVDDRARLFSLLWGEIPALTAA… |
| A0A8B3HLH8 | 165-323 | None |
| A0A7X3NB15 | 135-295 | None |
| A0A455VN62 | 131-272 | None |
| A0A4U9VWV2 | 1-121 | None |
| A0A448SS45 | 155-301 | None |
| A0A379WTK1 | 40-190 | None |
| A0A6D0ESE9 | 1-133 | None |
| A0A143HUP1 | 127-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.