DPCstruct | MC36149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 186 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 95.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447PAT6 | 19-208 | IRNIMLATLWCHDHLVHFYQLAGMDWIDVLNALKANPRATSQLAQSLSAWPMSSPGYFFDVQNRLKKFVDGGQLGIFRNGYWGHPQY… |
| A0A6N6X8R0 | 2-193 | IRNIILAAHTTHDHIVHFYQLSALDWVDITSALKADPAKASAMLNGVSSWHLNSAEEFTKVQNKIKDLVASGQLGIFANGCWGHPAM… |
| A0A1X7AAA4 | 40-236 | None |
| A0A1W1WVN2 | 93-277 | None |
| A0A379VPS7 | 1-203 | None |
| H6SN26 | 105-293 | None |
| A0A101G1N1 | 90-258 | None |
| A0A1G6CA24 | 12-197 | None |
| A0A1B6NQE5 | 143-334 | None |
| A0A2Z6TKL4 | 474-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.