DPCstruct | MC36145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 12.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 47.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447J5B4 | 1-107 | MESFCIAVAKALNLPGFGDNAIADNDGNTYPLNTAEDYYLRVAANTAFMGEKTGPEAKEADIRLSGVDRIMPVMQQVLKAEEISRVA… |
| A0A7C4WT84 | 10-117 | SMWEFLIDLAKRLGMPGFGEGGIKGVSGTKYEGKSFPLNSLWDYIMRVYANGAMDAVRRKIVPNEIPEEEVKFVEENYPIAQYKDII… |
| A0A379VSB7 | 1-107 | None |
| A0A0B8PCG6 | 8-119 | None |
| A0A0B8P1L5 | 6-129 | None |
| A0A0B8Q601 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.