DPCstruct | MC36144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 141 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3YK72 | 1-124 | VGLGVSCSPDRNIKAKITKDGIFLEELEKNPARFLPSKAPSMQPAVDIDLDRPMEEVLKELSEYPTKTRLNLNGTLIVARDIAHAQI… |
| A0A6N6X5J3 | 1-141 | DIRVIRLPRHGASCPVGMGVSCSADRNIKAKINREGIWIEKLEHNPGQYIPESLRQAGEGEVVKVDLNRPMKEILAQLSQYPVSTRL… |
| A0A4P0Y5H1 | 88-222 | None |
| U6LQS9 | 152-280 | None |
| A0A5E6NV32 | 2-156 | None |
| A0A0B8PZ94 | 47-182 | None |
| A0A376MTM9 | 1-144 | None |
| A0A2C9LV53 | 20-185 | None |
| A0A6P4GAC9 | 220-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.