DPCstruct | MC36138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6X2S6 | 16-121 | ASSALAHGYIESPASRAYMCKLGQNIDCGSVQYEPQSVEKTSGFPTGALPPDGQLASAGIANYSQLDKQSMNAWTKTPMTAGAHEFV… |
| E5L394 | 31-154 | RAEAHGVAMMPGSRTYLCQLDAKTGTGALDPTNPACRAALDQSGATALYNWFAVLDSNAGGRGAGYVPDGTLCSAGDRSPYDFSAYN… |
| A0A2A3E1C2 | 235-337 | None |
| W7BDP1 | 7-114 | None |
| A0A6S6RVQ5 | 1-97 | None |
| A0A3D3HTP6 | 10-108 | None |
| A0A7H4NS43 | 8-111 | None |
| D2TXX3 | 2-99 | None |
| A0A1B1L8Z1 | 18-142 | None |
| A0A8A8KHQ0 | 8-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.