DPCstruct | MC36136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 93 ± 16 aa |
| Standard deviation of domain lengths | 15.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3EXB4 | 1-71 | MIRVGEGTITDSGYRTMFAGATFESFDDHPNQLHTANGISSTAAGAYQFLYRTWRSLKLKLQLTDFSPKSQ |
| A0A6N0IG54 | 23-97 | RLRAFLRMIRIGEGTIQEDGYRTMFTGVKFTDFSKHPNIRHEANGVVSTAAGAYQFLYGTWRNLQRRYSFPDFSP |
| A0A376VKC2 | 11-105 | None |
| A0A3P8M196 | 43-141 | None |
| A0A1C0SYM8 | 12-105 | None |
| A0A7Y4TJ18 | 24-138 | None |
| A0A3D1PHP1 | 8-108 | None |
| V5BUW2 | 95-185 | None |
| A0A084XUR4 | 15-104 | None |
| A0A4R4CVL5 | 190-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.