DPCstruct | MC36134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 176 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5WY07 | 1-176 | MPGRRGASQFAALCHERAGVVGTTWLSVAQGGAVIEQAQILTMHNLALLTGPVGVTPPSGWAALARGAFATTCRLAARIHGNPRPLT… |
| D9VSN6 | 216-381 | APEFAALCAQRAGSDRAWSVAANGKVIEQAQVLTTHNLATLVGRAGVTVPGGWARPARECFETVCRLVARVEGNPRPLPAIKDAAYA… |
| A0A1A7C973 | 166-352 | None |
| A0A1Q9U8V9 | 252-414 | None |
| A0A7W9LKW1 | 381-570 | None |
| A0A846YWM9 | 72-234 | None |
| A0A850D8S6 | 269-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.