DPCstruct | MC36130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 366 |
|---|---|
| Mean domain length (aa) | 179 ± 45 aa |
| Standard deviation of domain lengths | 45.33 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 85.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04203 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3LCT4 | 41-228 | QQAHDLSQTWAAAYDEAPVVTDVPKADAPPVSADVPVYAGQPGNAEQFATLIVPRFGADWRRPIAEGIGIEDVLNAIGVGHYPGTAM… |
| A0A1Y4AVD6 | 17-151 | TAVTSDLYYSGGYLASLKIPSIGVNVKVYEGTGTTPLAKGAGHFTDTSIWDGNVCIAAHNRGTHAQFGKIHTLSAGDRVTLTTKLGT… |
| A0A430A7C9 | 142-305 | None |
| Q9ZB49 | 360-590 | None |
| A0A365D6C8 | 212-343 | None |
| A0A417DG68 | 196-374 | None |
| A0A123T662 | 2-134 | None |
| A0A2E9A069 | 366-539 | None |
| A0A542ZAH1 | 18-171 | None |
| A0A123T3S8 | 8-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.