DPCstruct | MC36127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 274 ± 54 aa |
| Standard deviation of domain lengths | 53.55 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10222 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8VDP1 | 279-579 | QHKSVWRHLWTHGFSISDSKASGALNGDRINLTLYYVLSNTPALLHEPIDKAEVTKLRTYLAYPDRCYEGHHTLQNDVLWKTVESDN… |
| A0A091DHK8 | 49-313 | YYMLSCSPAPLLSPSLSRREREQMEATLSYEDHCFSGHATMHAENLWPGRLGSVQQILQLSGLWRLTLQKRGCKGLVKAGAPGILQG… |
| A0A1I8ITS3 | 1-184 | None |
| A0A087YHF5 | 343-607 | None |
| A0A803K328 | 347-600 | None |
| A0A0V1CYY6 | 305-614 | None |
| A0A6H5G786 | 307-528 | None |
| W2T4Z9 | 1-293 | None |
| A0A2I0TX18 | 195-459 | None |
| V5GMD5 | 3-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.