DPCstruct | MC36121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 226 |
|---|---|
| Mean domain length (aa) | 245 ± 60 aa |
| Standard deviation of domain lengths | 60.44 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 11.65 |
| Pfam Score | 40.24 |
| Assigned Pfam label(s) | CL0116- PF03441- CL0179- PF20375- PF14249 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810EA22 | 51-272 | EYGQSQLAFEETPDPHFRLQLIDQTFQAELLFHPQKPLANIDEDGKLNKLRYHSLPRNQVLGQIEQGGMTETVTGEGWFDHQWGRDY… |
| A0A6J6UVR8 | 14-183 | HYLGEHHLDQPGRYVGSIVLRGEQIAVDSYGFRDRSWGPRSQFGVGLSSSSAQHGGYSYATASASDAFHTITMDFGSGCNNIHGYLL… |
| A0A6A6Z8L0 | 7-166 | None |
| Q64C98 | 60-329 | None |
| A0A661GSQ8 | 2-121 | None |
| A0A1D2S6D4 | 8-310 | None |
| A0A1C6BV23 | 224-403 | None |
| A0A838UJU2 | 9-201 | None |
| O45136 | 96-421 | None |
| A0A1W9QGR0 | 17-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.