DPCstruct | MC3612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 155 ± 28 aa |
| Standard deviation of domain lengths | 27.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9HZX2 | 3-151 | ISTGFGMRVLFVGLALALAVVMAQETPQEKKFFEVKITKDEIYSYNGIKFAGDYTSWESPSGQLALGRTEGGVTILVILGAGTFKIE… |
| A0A2V9UXV8 | 17-137 | SYQQLRNLALGGETVGVSNLTIHRDAGTFHLRSGIVCFVVPVAGKVTGAVFVGDGNFVLDPALPSENASLKMLTRESEFSETFTQAV… |
| A0A7W0NTS9 | 1-185 | None |
| A0A7V0UCQ4 | 1-162 | None |
| A0A3E0P482 | 32-216 | None |
| A0A2V8XR54 | 2-129 | None |
| A0A2V9JLB6 | 1-188 | None |
| A0A2V8UPJ3 | 151-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.