DPCstruct | MC36114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 188 |
|---|---|
| Mean domain length (aa) | 291 ± 63 aa |
| Standard deviation of domain lengths | 62.94 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.10 |
| Pfam Score | 83.51 |
| Assigned Pfam label(s) | CL0286- CL0016- PF03951- PF12437 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2QTE6 | 13-249 | SDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAG… |
| A0A218Z7Y7 | 1-348 | MASSTTVSYAANLLKYMALDQKGSAMAEYIWIDSTGGVRSKSKASKQRHFAPMATRTRDTSRLTSPQTLTSVPESGEFKVEDLPEWN… |
| A0A166AJH7 | 1-143 | None |
| A0A446IT65 | 176-496 | None |
| A0A0H2M766 | 480-840 | None |
| A0A7M5X9Z2 | 28-298 | None |
| A0A1I8IP23 | 13-358 | None |
| A0A447QNP2 | 20-251 | None |
| A0A1V5AV77 | 4-247 | None |
| A0A7R9Q2H4 | 9-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.