DPCstruct | MC36113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Standard deviation of domain lengths | 8.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061AQT4 | 7-69 | NHPYKTTDAKNDEKEHVCKRDFGPDAPNQDASHKSRSDGSFEYSNYDKSKYTNDGKGTETYTP |
| A0A218Z530 | 10-80 | SNPYTPYTINSSGSNSQGNSYDNRTQPSGSAYHYSNTNGSYYYSNGNSSTYYNDGKGSSTYTAPNGNVYKK |
| A0A3N4IAB3 | 1-76 | None |
| A0A4U0V3G9 | 24-85 | None |
| A0A067BF49 | 1-64 | None |
| A0A284QQ88 | 15-72 | None |
| A0A817MGP1 | 1-66 | None |
| A0A388LDS9 | 7-67 | None |
| A0A7R9WQK4 | 61-127 | None |
| A0A6A6PSR9 | 37-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.