DPCstruct | MC36110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A075I1E0 | 5-80 | EINGNLSQSSFWNFDALFTPQDHPARELQDTFYLKGLNAKQLATPTQIKNVSNAHKKGWRYYWDIQEAKKWFCEHI |
| A0A4C1TB13 | 1-79 | MPTNNYVESSFWNFDALFQPQQHPARDAHDTFFINYPSKSYKFPQEYLQRVKEVHSRGGYGSQGYGYDWKLEEAQKNLL |
| F4PXN0 | 640-722 | None |
| A0A453PNB9 | 93-177 | None |
| A0A453PNF5 | 210-294 | None |
| A0A7J2J6F6 | 168-242 | None |
| A0A5B7D429 | 259-343 | None |
| A0A811LMT5 | 341-423 | None |
| A0A4Y7J054 | 744-836 | None |
| A0A2R6CSQ8 | 235-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.