DPCstruct | MC3611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5GH87 | 1-98 | MNKNEILRVAANEFAEKTHKLSSPLEIAIIGSVAGNDPYPNDLDLVIIIRNLEEIAAVAKYARQMSRHYHGWEVFLFDENVSIIGRI… |
| A0A1F2QZ75 | 1-117 | MSTMNATSEDHRKHLLDGLRRFLPSVRQMAGVRRIAILGSIVTTKPDPKDIDILVVVADDADLAPLATCARRLQGHAQSFNRGTDVF… |
| A0A3N5JN09 | 1-108 | None |
| A0A1J5SBF3 | 182-287 | None |
| A0A6A2G8P1 | 5-105 | None |
| A0A7V3FYI8 | 1-112 | None |
| A0A7W1SDQ4 | 15-118 | None |
| A0A2G9XXR1 | 142-250 | None |
| A0A1F5UU58 | 4-98 | None |
| A0A352D731 | 59-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.