DPCstruct | MC36108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 131 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6LEV5 | 11-149 | MDAIRTFLNALGCFDELLSLEEEFGNFLEAAKIAKLKGELLVEADLFGKAGHFKQSAMLILWYVFANSLWSSGSKGWPLKQFPQKEE… |
| A0A5E4GLV7 | 1-124 | MRNFLKKLALLDELLLLEIEFGNYLEAAEIAMMKGDILLEADFLGKAGKFREASLHILFYVLANSLWSYGRKGWPIQQFSQKEELLS… |
| A0A1D6E0S0 | 15-146 | None |
| A0A7J6W032 | 310-442 | None |
| A0A2U1MD81 | 1-144 | None |
| A0A067KC60 | 457-595 | None |
| A0A0P0WE98 | 1638-1770 | None |
| A0A396I9S5 | 88-223 | None |
| A0A287RVF2 | 715-830 | None |
| A0A843W018 | 968-1099 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.