DPCstruct | MC36107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 177 ± 19 aa |
| Standard deviation of domain lengths | 18.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4G9Y5 | 2-191 | EDECLSLLLWLEERYETVYTRHPGFQKGSKPLLAVDNPFPMELPENLVGEKWAFVQLPFSAVQEEISSLDSNLVFGASLDLDLLGIE… |
| A0A7S2PC18 | 1-154 | FLDIRTPVKLPDALRGEKYAFVSLPLAEFKEGGGVSEDNIGVGRLCPVDNDLPGDAFVQGIVLMTPRANALASWLGGTEVASLKCDL… |
| A0A0M2PP39 | 184-344 | None |
| A0A2N9GIK0 | 237-426 | None |
| A0A7S1YY94 | 131-316 | None |
| A0A6A1VAX1 | 111-294 | None |
| A0A7S2TVR1 | 198-395 | None |
| A0A535UEI2 | 252-393 | None |
| A0A2P6V8H2 | 505-696 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.