DPCstruct | MC36105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 5 aa |
| Standard deviation of domain lengths | 4.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183DHI1 | 38-138 | IFDEIRQNPTKGYLTYKTETNSDGTTFEAYQEFHPFKFSQLNDKQCKEFDSFSDCVDEFFSKMESQKIETKALNAERDALKKLDNII… |
| A0A820DPH2 | 1-100 | MDYLKQADSGECKGYITYRQEGSASLLSYEEFHPFLFKQFELKSYLELPTFDRAVDEFFSKLEAQRLDGHIVQKERDALKKLENVKK… |
| A0A445B9F2 | 144-246 | None |
| A0A395IXN2 | 43-138 | None |
| A0A653BH25 | 156-247 | None |
| F6HE06 | 142-236 | None |
| A0A446TYH9 | 309-413 | None |
| G7Y443 | 204-304 | None |
| A0A0T6BBR1 | 38-142 | None |
| A0A835UXZ8 | 288-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.