DPCstruct | MC36104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 234 ± 28 aa |
| Standard deviation of domain lengths | 27.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10408 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7F3E3 | 182-416 | WKDSPLASRHREMLKRCKTQLKKLVRAKACADVGLLDENLLRRSLQFYSTVIQLILRMVDPAYPNITLPLNPEIPKSFAALPEFYVE… |
| A0A820D0X9 | 9-270 | RNTIIPKGRFRHLAIFSYGLTAFLNIKTVLNEPRLLELSNALFTASCSWLVHLASLSDQVENEEVIQKIKQLPLISKPNRQLSYIPE… |
| A0A7J7LXL8 | 261-472 | None |
| A0A1B7N6D4 | 620-861 | None |
| A0A7J7ME79 | 409-634 | None |
| A0A446JKK5 | 61-267 | None |
| A0A099NYT3 | 144-398 | None |
| A0A0N4WDL6 | 314-538 | None |
| A0A485NF66 | 375-615 | None |
| A0A813KDJ0 | 371-596 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.