DPCstruct | MC36103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 74.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820CY04 | 1-78 | VDSHGLKAVRKAKLHYNSIEINPEHMRRLAVEQSQTLSNDSVSYVVAKYYLYMKYVHTFIFALGTIIPMRPDDVLRKG |
| A0A1S4DQL4 | 269-358 | GLKAVTKAKLGYDPLEVNPEDMVRFAMEKPQMMASYSVSDAVSTYYLYMTYVHPFIFSLATIIPMPPDEVLRKGSGTLCEMLLMVQA… |
| A0A7N4NHU2 | 34-139 | None |
| A0A820TU10 | 32-109 | None |
| A0A183KUH9 | 371-460 | None |
| A0A4Z2BBN7 | 335-424 | None |
| A0A817MQE7 | 133-210 | None |
| A0A3L6FXY0 | 171-263 | None |
| A0A287F4V8 | 480-569 | None |
| A0A7N6A2D8 | 53-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.