DPCstruct | MC36101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820APS5 | 1-94 | YSGILEDDEDFEEWMKEWKTIKEDKKLVHMQQLFQMLLANDTTEYYYSFCENNIYENDCHWHCRTCQKCMSWREWHCTQCNKCTYGA… |
| A0A139H9I6 | 177-273 | EDDWIQKWQAKKETLSADQLPEHMNELFRYGLFIPKNSCIAHYFSLCRAYGNSMGTWQEDDCTWHCPVCKECHDWREWHCSNCKKCT… |
| A0A822FG35 | 1-81 | None |
| A0A423XBS2 | 187-302 | None |
| A0A1L7WRN0 | 120-228 | None |
| A0A819H2M3 | 92-195 | None |
| A0A395IMJ6 | 158-265 | None |
| N4V918 | 156-276 | None |
| A0A4U0VJC7 | 12-114 | None |
| A0A820J856 | 55-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.