DPCstruct | MC3610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 9.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810AIQ4 | 2-66 | IEAPWTDAQVENLNRWQQSGHVHPFTCPNHHDASRVLIAKPDGWHCPGCEYTQTWAHAGMVLGPP |
| A0A1I7MBL6 | 3-69 | ERTEAPWTDAQVEALNRFQALRLFHPFTCPNHSGMRDKDRALVATRHGWRCPHCSYTQGWAHRWMLT |
| A0A5C7Q1P3 | 1-66 | None |
| A0A6G8U5Z5 | 6-73 | None |
| A0A0R3MM88 | 1-75 | None |
| A0A0F9QBT1 | 3-79 | None |
| F8XNE3 | 5-84 | None |
| F8GXR1 | 2-87 | None |
| I4AJN4 | 1-79 | None |
| A0A6I4MRJ5 | 45-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.