DPCstruct | MC361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 182 ± 31 aa |
| Standard deviation of domain lengths | 31.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0WQQ4 | 14-161 | YPWATNRVAVHHSLVELSRRGIFTIKGEARCRRCDVRKEFVYDIEAKFRELEDYLRRNCMSMNDRASERWKNPIVPNCDGCGQQNCM… |
| A0A3P6GJ81 | 75-260 | MQPPFEQSFNVFPSSSFTSPTRPVMRPAASGAVSRRSYRSQSSVNRKDDTIPPPFPWATNKRGWIQSLENLASKQITTITGEVQCKH… |
| A0A6V7PBA8 | 158-325 | None |
| M4DCG8 | 122-350 | None |
| A0A6A4NFW2 | 11-158 | None |
| A0A5A7P8C0 | 22-191 | None |
| A0A6J1I8I0 | 399-598 | None |
| A0A6A6LZT8 | 13-215 | None |
| A0A6A3CBG3 | 27-199 | None |
| A0A7J6VMV6 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.