DPCstruct | MC36098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 224 ± 4 aa |
| Standard deviation of domain lengths | 3.99 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 35.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13705 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A336M4R1 | 269-494 | TEDKSLGTVSAILFYILALQTGLTSLEPEKRFVRLCRNFCLLITAMFHFLHNLVAPTLMSLSAARNPSRERHFRALLASIFLLITPT… |
| A0A7M7KSB1 | 435-657 | IIRGSRLFLEAEHEDNPMHSGWTQGLTLVLLGLQTGLMQMELPSRTLALLVILFVVASSLLQNILEITEPVVLSLNASRSLTKWRHI… |
| A0A2K6CNJ5 | 316-533 | None |
| F1PKC3 | 546-773 | None |
| A0A7R9BCB4 | 298-515 | None |
| A0A7M7L5W6 | 335-557 | None |
| J9K6E2 | 266-486 | None |
| L5LEH8 | 86-313 | None |
| A0A0N4WLG1 | 330-558 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.