DPCstruct | MC36090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0Y4W5 | 69-149 | SNNVLKDGEDCWNVMASDHDDMYTVNKLNDSCGRQIVCDECKTCIYCFSCTCIDSAIQLNFCKHIHLVCISDKAQYKNTNS |
| A0A6P7H5T2 | 132-221 | LNKVIKSDIGWLVPSNSRNEMYTIQKVKENCPCRLVCEDCEACLHCYTCTCLDSCIKWNMCKHIHLICKYTQMDLTKESTIPNINFL… |
| A0A653DE91 | 324-416 | None |
| A0A6G0U2V8 | 186-275 | None |
| X1WLR0 | 130-228 | None |
| A0A7M5UEL7 | 270-362 | None |
| D7ELC0 | 73-173 | None |
| A0A6P7GYH6 | 115-203 | None |
| A0A6J2XMN6 | 5-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.