DPCstruct | MC3609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 230 ± 45 aa |
| Standard deviation of domain lengths | 45.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7M6I9 | 2-250 | AGAAVQGSLAGLPERLDKLLQFDLPAQQSAVSQVRQMKPEDAEHVLGRVITRLQTQADESGACVTALQEPRRRGLLTPSQVPEVHDK… |
| A0A5E7FPL5 | 5-204 | AGIERRIRDQQKKLQDPERREYLSPLDWEDMLTQHAKKLETLAEEIQRNHSTDANAAALSSAYLEEAKAVTKLAREVRSEGYKQQLP… |
| A0A2N5EXZ3 | 813-1025 | None |
| A0A5E6VC00 | 356-576 | None |
| A0A7T4RM61 | 10-155 | None |
| A0A423KUM5 | 532-754 | None |
| A0A1N7U7M4 | 590-821 | None |
| A0A328YG89 | 24-324 | None |
| A0A0Q8DF96 | 36-261 | None |
| A0A0K3A4E9 | 108-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.