DPCstruct | MC36087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 231 ± 29 aa |
| Standard deviation of domain lengths | 28.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9ZTE9 | 2-235 | LSRTRAQRYLRYSLRLTRCRGPLAMGDLAYTTTLLPGEKVRLFTSDRRSKFSFDTSTKFGYRNTQSSEESFFMQQMSDSLFDTNSRD… |
| A0A3N1GH40 | 300-524 | VRKFSVSAVSSVPRHRLMLVECLRLSNFLGRYGAGRIVQTFSLLPGEKTNITIRTFNTASTTATNTSSVFDSFSETTDDELTSAIAN… |
| A0A2S1FJC8 | 256-499 | None |
| A0A538QNQ9 | 282-494 | None |
| A0A6I4TXM5 | 291-558 | None |
| A0A5R9PIT1 | 131-404 | None |
| A0A7X6ND48 | 194-426 | None |
| A0A315BSU2 | 396-585 | None |
| A0A0W0S3V0 | 179-381 | None |
| A0A519PH91 | 430-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.