DPCstruct | MC36083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 153 ± 15 aa |
| Standard deviation of domain lengths | 14.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14096 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C7PQU5 | 16-168 | ELVISYAKQADARELHQMAMEWNWDDDKPFLHWLIENPATDRGTILMIYWKYGPRYWKQFKDREHVLAEDEYVESFDIIENIEQKYT… |
| A0A330GV50 | 1-159 | MDENELGIRRQIAWLETASPDDWHRAVLDFNWDWDIDPLFWIARQPQCDKAMALTMFWKGQPVWYLLMALENGGSDTNREPLWDMLK… |
| A0A418VB89 | 10-165 | None |
| A0A418VB97 | 22-174 | None |
| A0A4S1WLP9 | 166-333 | None |
| A0A1Y5T4L4 | 163-325 | None |
| A0A3B8RRJ3 | 7-155 | None |
| A0A6G8BXC5 | 31-191 | None |
| A0A519SK45 | 1-143 | None |
| A0A1H6TJQ6 | 201-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.