DPCstruct | MC36080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 5.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03837 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656QMX5 | 24-81 | GYIERFASIMATAGETIPGQYRNNPGNCAAVTIQALIWGMNPFALAAKTHFVGGSIGY |
| A0A7W0DYW8 | 1-61 | MQNIVAFADFMCKAVITVPKHLQGTSSDCLAITMQAMQWGMNPFAVAQKAHLVNGNLGYDT |
| A0A657GXG9 | 1-73 | None |
| A0A5E7B6M4 | 3-63 | None |
| A0A8B4MPI4 | 28-78 | None |
| A0A8A7BL92 | 6-63 | None |
| A0A485ASV5 | 1-60 | None |
| A0A2U1SSW1 | 52-115 | None |
| A0A3M3KJB9 | 44-101 | None |
| A0A269PI99 | 25-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.