DPCstruct | MC3608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0CQF8 | 6-98 | GLFAVDFDGLRSDGGFAFKIGYVLDGGDSNDQPSVSKLRLFENGVELHPPHTDHQDIRDYGKGRFSHWGTTLYFSTSDNTDPVANGR… |
| A0A1I7HGH1 | 187-281 | KPREVLISSASGASDGQTWTSILPDHVPPGDNNSNPIASVLGLFEDGKLLGPPHSSHETIRTIGKGAYSHWGSALYFSTSDGSDPNT… |
| A0A560MBR0 | 62-158 | None |
| A0A535EUE2 | 78-178 | None |
| A0A833FXE2 | 44-155 | None |
| A0A6J5E433 | 460-563 | None |
| A0A2P5L939 | 4-93 | None |
| A0A812IMI1 | 37-146 | None |
| A0A3M1FR63 | 5-98 | None |
| A0A4Q3VK71 | 705-797 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.