DPCstruct | MC36076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 368 ± 40 aa |
| Standard deviation of domain lengths | 40.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8BUD6 | 213-552 | QCSGCHGSSVNSAPPVDLNGASNTDVVTVGAHQRHLEGGVVRNPISCDDCHVVPNAVDDEGHLGPAPADMTWGTLGQTDGASPAWDR… |
| B4UJD8 | 17-455 | ATAACDQARPTLGEAGAGAEGDCTSCHGDATRSEASALLQAAPPRDAHGSASGPAVGAHQAHLHATAVSGPIACAECHAVPAQRLHS… |
| A0A2E5HJ46 | 199-508 | None |
| A0A059XBQ9 | 47-424 | None |
| A0A7T9DI76 | 29-386 | None |
| A0A7T9DEC0 | 150-532 | None |
| A0A7W0QDJ5 | 17-399 | None |
| A0A1L6L0Y9 | 7-299 | None |
| A0A661NAN6 | 597-1025 | None |
| A0A1J5DI59 | 48-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.