DPCstruct | MC36073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7SXJ7 | 244-386 | IKRRKKSEHEFGAATARVYLWVEALNVAALAGIALASIVYFYANRLIPAALAGRESWEIRAFFLAWAASLAHAGWRGPRRAWIGQLA… |
| A0A239RY25 | 2-129 | SFGHQLVEKLNIATIAGLPFAIAMYFWANRLIPVPFDGRADWEVHSLFIAWLLTLIYAIFRPLMKAWREILAFAALAWLLLPILNFF… |
| A0A3R8VDL3 | 191-313 | None |
| A0A0K6HP50 | 33-159 | None |
| A0A252BMD8 | 4-123 | None |
| A0A149SEE8 | 121-244 | None |
| A0A177G690 | 4-105 | None |
| A0A149VGY2 | 11-128 | None |
| W5Y8C4 | 156-289 | None |
| A0A1W1IA47 | 270-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.