DPCstruct | MC36072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 160 ± 21 aa |
| Standard deviation of domain lengths | 20.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 17.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A679IW85 | 2-147 | GKRPVIVDVATLADLLGVHIRQIPKFADAGTVVRVAHGEYDRDASIRLHVEHLRKVAGGRSQSSTLAAERERLTKAQADAAELKLAA… |
| A0A1R7Q9M5 | 1-158 | MSAVIKGQEVTRQGLADIFGVSLPTIDNWVRSGCPYIQKGGRGQEWKFNTAAVSNWLRERDVEDATGEIPDDIELLRIRKQKAETEL… |
| A0A3N1QNW8 | 8-164 | None |
| A0A845PP00 | 1-158 | None |
| A0A3B9ZIR9 | 45-195 | None |
| A0A1Y4I0K1 | 59-237 | None |
| A0A3R7D7B6 | 1-162 | None |
| A0A7C1MHK2 | 9-170 | None |
| A0A4R5HEY6 | 3-159 | None |
| A0A0G1DYG0 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.