DPCstruct | MC36071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 253 |
|---|---|
| Mean domain length (aa) | 88 ± 15 aa |
| Standard deviation of domain lengths | 14.84 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.18 |
| Pfam Score | 94.78 |
| Assigned Pfam label(s) | PF01201- CL0110- CL0260- CL0376- PF01486 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833VVM5 | 8-88 | GETKKVKRGRVKLARIEDKTSRQVRFSKRRSGLFKKASELAVLCDAEVALLVFSPAGRLFEFSSCSWYFTLLPCAKQERAY |
| A0A183IZY2 | 4-67 | EVTFTKRKFGLMKKAYELSVLCDCEIGLIIFNSSNKLFQYASTNMDAVLLKYTEYNEPHESRTN |
| A0A368QVA5 | 29-157 | None |
| A0A6P8CFF3 | 50-141 | None |
| A0A1S8W1X3 | 148-255 | None |
| A0A7N2L6I2 | 3-126 | None |
| A0A0E0GJU3 | 9-106 | None |
| D7UBC1 | 1-78 | None |
| R9P9A4 | 1-82 | None |
| A0A445JJY2 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.