DPCstruct | MC3607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 302 ± 29 aa |
| Standard deviation of domain lengths | 29.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A328ZFA0 | 8-369 | LAAPRKRAWPEAAVGAGRPWVGERPGSPREMVENAVARLRIAWSVGDPDLTADHWIASAEWSFRDLAQALEARRREVGARLAALGAA… |
| A0A2M8Z6Y6 | 7-327 | LAGLAVAAGAAGIIKGGEAISNNSKAKDLVNEAQRIYDEAKERLDYQRIETTGNLDSLGRVKLEAWSGEIGSFIQLFKTFKNVSLQG… |
| I0EPY0 | 13-337 | None |
| A0A661HQK1 | 3-327 | None |
| A0A1T5G8F5 | 13-310 | None |
| A0A1C5RRJ8 | 1-308 | None |
| T5JXG5 | 13-293 | None |
| A0A1H9YA66 | 29-331 | None |
| A0A432QYG3 | 16-306 | None |
| A0A133SBL7 | 1-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.