DPCstruct | MC36069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 117 ± 15 aa |
| Standard deviation of domain lengths | 14.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9EF76 | 258-387 | AVVMGETLAVGGPLVEAVGAYLKVDMADWWTPDDAFFGLLRDRAVANALLRDVGGKRIADANVAENVKTQKIILRDFLAGTGGRAKV… |
| A0A2A4Z7G4 | 2-112 | ESNTSMTEVLGNEFKVNMWDFWQPEGHFFDLIRDKNAINAMVADVGGKEVADGNVTSTAKIQKKIIDDFLIGTGREQVLDWMPNYMK… |
| X6JEJ8 | 183-285 | None |
| A0A2G2D680 | 15-114 | None |
| A0A160UKX7 | 118-235 | None |
| A0A1G5RF44 | 157-256 | None |
| A0A1H9MHI3 | 76-206 | None |
| A0A7U7GG90 | 11-143 | None |
| A0A062VGG8 | 8-138 | None |
| X6I1A7 | 257-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.