DPCstruct | MC36067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 125 ± 10 aa |
| Standard deviation of domain lengths | 10.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T4K290 | 1-137 | MMSVVLIFFCKRYISRYTEISARYCLDSMNSELFDIDQKLIRKEITEDEAKNQKQQVATKINYYSALDSSAQVLEKTITAFILLFIV… |
| A0A7T9DEX4 | 139-255 | VQYLVIAKGAERVAEVGARFVLDSMPGKQMAIDSDMRAHAIDFRQASSRRKTLERENQFYGAMDGAMKFVKGDAIAGIIITLINILG… |
| A0A800C6J1 | 2-103 | None |
| A0A0U1HH72 | 129-263 | None |
| A0A080JBT5 | 3-133 | None |
| A0A090RZD9 | 7-127 | None |
| B7R847 | 115-231 | None |
| H5V0T0 | 2-117 | None |
| A0A489FML9 | 121-237 | None |
| A0A381GS07 | 4-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.