DPCstruct | MC36053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 150 ± 20 aa |
| Standard deviation of domain lengths | 19.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.57 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | PF04178- CL0073- PF04176 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0CZB1 | 25-184 | EKEEEKSFMKEFEEALPSLTYQQRLTGFAICFGLGWVTSFLSAAFLPRITTPTGAAMFALFYTLGNLISIFSSCFLWGPCAQFKAMV… |
| A0A5F4CGU3 | 223-361 | NLMVVEASSLSWSTRIKGFIACFAAGIVCSLLGTLLLWVPRKGLYLFAVFYTFGNIASIGSTVFLMGPMKQLKRMFEPTRLIATIMV… |
| Q4UBA2 | 34-179 | None |
| A0A820ZBR3 | 440-582 | None |
| A0A813XZ92 | 26-143 | None |
| L5KGT5 | 127-284 | None |
| A0A7S2STQ3 | 71-217 | None |
| A0A667IKD0 | 17-146 | None |
| A0A812XY56 | 32-181 | None |
| A0A2K5HMK3 | 3-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.