DPCstruct | MC36052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 158 ± 18 aa |
| Standard deviation of domain lengths | 17.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8WZ36 | 149-327 | IIFWRLNANVTDEAENRRNQLMILAALIVFSGVLCLFFDRTWLFSLSPLSKVPIYCVLGISISFALTFSLIDLINYLIGFIQGSITR… |
| A0A7S0CWD7 | 1-158 | EHPRPILLGTYSSLVMLAGLLCFALESNWVINMSASAKVPLYSILGIAVTFALLFSIIDLVNFCHGSCISTPGRALVETETQVLLIV… |
| A0A0H5RS83 | 1-160 | None |
| A0A6S8FUZ3 | 62-209 | None |
| A0A7S0TWC1 | 18-168 | None |
| A0A7J6SE91 | 205-341 | None |
| A0A813C1M4 | 1-118 | None |
| A0A7S2TW05 | 38-206 | None |
| A0A0M0JJ92 | 61-230 | None |
| A0A2T7IG35 | 131-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.