DPCstruct | MC36047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 299 ± 49 aa |
| Standard deviation of domain lengths | 48.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y9IM21 | 45-315 | CQPQVVERCWAGEVCLAATRKCVTPQLHDCSSFCHPVGGELSAELGICQCQEYVSAEELCDAQCLARAPQLALAWGSSRQLILSVKS… |
| A0A086LTR5 | 30-336 | RSPCEAKLYPRCASGSHRDDFGACVFEAEVECGESCRGGSGSFLAAFGVCQCADGPRIAAQCTSTCKEQLPQVFVSDAGFEEIDSVQ… |
| A0A455B319 | 21-241 | None |
| W5PWX9 | 3-269 | None |
| U6JVI8 | 9-274 | None |
| A0A1B0GT42 | 77-365 | None |
| A0A7J5YE55 | 78-341 | None |
| A0A6I9XDT1 | 23-346 | None |
| A0A4Z2CCG9 | 27-449 | None |
| L9KXM4 | 158-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.