DPCstruct | MC36044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 16.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7TGN2 | 88-217 | CATLPCNPGQNCTYSQGYWKNHSDVWPLQNLTLGAVSYNKSQLLQILNRPAQANGLVILAHQLIAAKLNIANGADPAAVQQSVIDAD… |
| A0A7S7NZ41 | 65-187 | APKGCVRTQGYWGNKPDVLWPKYDRNAVFYASGLSWQQVFDSPPRGDAYYILAHQYIAAVLNLASGASAPNSLRSVVVAANIWFNTA… |
| A0A2L0F890 | 39-173 | None |
| A0A535A6S0 | 375-542 | None |
| A0A3N5GH53 | 82-206 | None |
| A0A535AGB5 | 3-117 | None |
| A0A2N6FVP6 | 168-326 | None |
| A0A7X0R4G1 | 218-342 | None |
| A0A1G2MGA4 | 246-386 | None |
| A0A653JIS6 | 541-674 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.