DPCstruct | MC3604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D0QS78 | 12-88 | FPEGIDPLYPVTIVKTRYSGSYEGGTFAAFLTEPWDVPQDAFADDRVAYGWWKEHGGMIGVGDTPDEALASLRSKLT |
| A0A2W2E1W2 | 3-60 | VTIVMSRYGGIYEPGVWVAFPMNPDELPPDWYGGDVECAHFFAERKGEIGGGDTPQDA |
| H0PYW0 | 64-130 | None |
| A0A431M0I2 | 53-124 | None |
| A0A849I332 | 30-109 | None |
| A0A1H5VVT4 | 7-96 | None |
| A0A0M8TIN3 | 49-126 | None |
| A0A7V2EED7 | 16-103 | None |
| A0A133VP07 | 1-71 | None |
| A0A1H0Y5F3 | 6-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.