DPCstruct | MC36038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 173 ± 24 aa |
| Standard deviation of domain lengths | 24.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.52 |
| Pfam Score | 87.56 |
| Assigned Pfam label(s) | CL0020- PF04836- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812A1X5 | 135-305 | LNMKRAEFSSLLAWTLLLTICPINEVKKGWRVTFFYEDMESLTQMLRALATDGNKHRAKVDKRKQWSVFRDILRAVEERDFPTETVK… |
| F4WWD5 | 153-322 | LNRLRELLESPHLDVRLSAGEALAIIFELGRDFSCDYEQNWALDLIEILKELATDSNKYRAKKDRKQQRANFRDILRYIEEDIVPEM… |
| A0A556UFH8 | 284-416 | None |
| V4M4P0 | 23-211 | None |
| A0A075AHA8 | 542-708 | None |
| A0A820BRP7 | 23-188 | None |
| A0A367J0C5 | 7-196 | None |
| A0A818FVT1 | 9-146 | None |
| A0A453Q0T5 | 1-227 | None |
| A0A397EYX1 | 361-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.