DPCstruct | MC36037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 166 ± 33 aa |
| Standard deviation of domain lengths | 33.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 50.59 |
| Pfam Score | 98.18 |
| Assigned Pfam label(s) | CL0020- PF01722- CL0652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811ZNG0 | 1-141 | MGFLLRVHCWQYSQLSELHRAPHPTWPHKARRLGYKAQQGYVIYQIHVRHGGHEHPVPRWSLPIAFSLLQRREMDATHCGALRVLNS… |
| A0A4S4E1W0 | 516-710 | AGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQ… |
| A0A4U0VUZ9 | 118-263 | None |
| A0A0V1A1F4 | 526-702 | None |
| A0A0B7NGN9 | 515-690 | None |
| A0A7J2HFL2 | 2-110 | None |
| A0A5D2LC79 | 40-189 | None |
| A0A0E0HPK2 | 272-478 | None |
| A0A498KSE3 | 12-188 | None |
| A0A1V6SWC9 | 440-629 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.