DPCstruct | MC36032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 60.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5J6Q0 | 123-198 | DDISLNPLPLRHVDYLSHNWEEEQIWESWKLIVSTRGEYSNAPRLENASWRAWMKSKSRLKTVSPETINWLKDCDV |
| A0A0W0EW76 | 17-88 | VPDDSSLETQPRAQVDYLSHDWREEDVWRSWRNMTRQKNEIANGMRLENASWRTWWKQRNKLKTVNPETLNW |
| A0A015LD10 | 1-78 | None |
| A0A4Y9XMG3 | 21-91 | None |
| A0A166D5N7 | 2-94 | None |
| A0A0D0VDG3 | 2-96 | None |
| A0A3M7BRN1 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.